IFI27L1 (NM_145249) Human Recombinant Protein

CAT#: TP315576M

Recombinant protein of human interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified IFI27L1 protein (Cat# TP315576). The protein was produced from HEK293T cells transfected with IFI27L1 cDNA clone (Cat# RC215576) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215576 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAI
  LQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_660292
• Locus ID: 122509
• UniProt ID: Q96BM0
• Cytogenetics: 14q32.12
• Refseq Size: 732
• Refseq ORF: 312
• Synonyms: FAM14B; ISG12C
• Summary: Plays a role in the apoptotic process and has a pro-apoptotic activity.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane