IFI27L1 (NM_145249) Human Recombinant Protein
CAT#: TP315576
Recombinant protein of human interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215576 protein sequence
Red=Cloning site Green=Tags(s) MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAI LQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660292 |
Locus ID | 122509 |
UniProt ID | Q96BM0 |
Cytogenetics | 14q32.12 |
Refseq Size | 732 |
Refseq ORF | 312 |
Synonyms | FAM14B; ISG12C |
Summary | Plays a role in the apoptotic process and has a pro-apoptotic activity.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404190 | IFI27L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407983 | IFI27L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404190 | Transient overexpression lysate of interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 2 |
USD 436.00 |
|
LY407983 | Transient overexpression lysate of interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 1 |
USD 436.00 |
|
PH315576 | IFI27L1 MS Standard C13 and N15-labeled recombinant protein (NP_660292) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review