RASSF1 (NM_007182) Human Tagged ORF Clone

SKU
RG213525
RASSF1 (tGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 1 (RASSF1), transcript variant A
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$886.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RASSF1
Synonyms 123F2; NORE2A; RASSF1A; RDA32; REH3P21
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG213525 representing NM_007182
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGGGAGCCTGAGCTCATTGAGCTGCGGGAGCTGGCACCCGCTGGGCGCGCTGGGAAGGGCCGCA
CCCGGCTGGAGCGTGCCAACGCGCTGCGCATCGCGCGGGGCACCGCGTGCAACCCCACACGGCAGCTGGT
CCCTGGCCGTGGCCACCGCTTCCAGCCCGCGGGGCCCGCCACGCACACGTGGTGCGACCTCTGTGGCGAC
TTCATCTGGGGCGTCGTGCGCAAAGGCCTGCAGTGCGCGCATTGCAAGTTCACCTGCCACTACCGCTGCC
GCGCGCTCGTCTGCCTGGACTGTTGCGGGCCCCGGGACCTGGGCTGGGAACCCGCGGTGGAGCGGGACAC
GAACGTGGACGAGCCTGTGGAGTGGGAGACACCTGACCTTTCTCAAGCTGAGATTGAGCAGAAGATCAAG
GAGTACAATGCCCAGATCAACAGCAACCTCTTCATGAGCTTGAACAAGGACGGTTCTTACACAGGCTTCA
TCAAGGTTCAGCTGAAGCTGGTGCGCCCTGTCTCTGTGCCCTCCAGCAAGAAGCCACCCTCCTTGCAGGA
TGCCCGGCGGGGCCCAGGACGGGGCACAAGTGTCAGGCGCCGCACTTCCTTTTACCTGCCCAAGGATGCT
GTCAAGCACCTGCATGTGCTGTCACGCACAAGGGCACGTGAAGTCATTGAGGCCCTGCTGCGAAAGTTCT
TGGTGGTGGATGACCCCCGCAAGTTTGCACTCTTTGAGCGCGCTGAGCGTCACGGCCAAGTGTACTTGCG
GAAGCTGTTGGATGATGAGCAGCCCCTGCGGCTGCGGCTCCTGGCAGGGCCCAGTGACAAGGCCCTGAGC
TTTGTCCTGAAGGAAAATGACTCTGGGGAGGTGAACTGGGACGCCTTCAGCATGCCTGAACTACATAACT
TCCTACGTATCCTGCAGCGGGAGGAGGAGGAGCACCTCCGCCAGATCCTGCAGAAGTACTCCTATTGCCG
CCAGAAGATCCAAGAGGCCCTGCACGCCTGCCCCCTTGGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG213525 representing NM_007182
Red=Cloning site Green=Tags(s)

MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPATHTWCDLCGD
FIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIK
EYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDA
VKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALS
FVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007182
ORF Size 1020 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007182.5
RefSeq Size 1968 bp
RefSeq ORF 1023 bp
Locus ID 11186
UniProt ID Q9NS23
Cytogenetics 3p21.31
Domains DAG_PE-bind, RA
Protein Families Druggable Genome
Protein Pathways Bladder cancer, Non-small cell lung cancer, Pathways in cancer
Summary This gene encodes a protein similar to the RAS effector proteins. Loss or altered expression of this gene has been associated with the pathogenesis of a variety of cancers, which suggests the tumor suppressor function of this gene. The inactivation of this gene was found to be correlated with the hypermethylation of its CpG-island promoter region. The encoded protein was found to interact with DNA repair protein XPA. The protein was also shown to inhibit the accumulation of cyclin D1, and thus induce cell cycle arrest. Several alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, May 2011]
Write Your Own Review
You're reviewing:RASSF1 (NM_007182) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213525 RASSF1 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 1 (RASSF1), transcript variant A 10 ug
$686.00
RC213525L1 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 1 (RASSF1), transcript variant A, Myc-DDK-tagged 10 ug
$986.00
RC213525L2 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 1 (RASSF1), transcript variant A, mGFP tagged 10 ug
$986.00
RC213525L3 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 1 (RASSF1), transcript variant A, Myc-DDK-tagged 10 ug
$986.00
RC213525L4 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 1 (RASSF1), transcript variant A, mGFP tagged 10 ug
$986.00
SC313020 RASSF1 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 1 (RASSF1), transcript variant A 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.