Rabbit Polyclonal Anti-TBC1D16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBC1D16 antibody: synthetic peptide directed towards the N terminal of human TBC1D16. Synthetic peptide located within the following region: EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG |
Rabbit Polyclonal Anti-TBC1D16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBC1D16 antibody: synthetic peptide directed towards the middle region of human TBC1D16. Synthetic peptide located within the following region: RGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAF |
TBC1D16 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TBC1D16 (NP_061893.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China