TBC1D16 Rabbit Polyclonal Antibody

CAT#: TA344160

Rabbit Polyclonal Anti-TBC1D16 Antibody

Product Images

WB Suggested Anti-TBC1D16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBC1D16 antibody: synthetic peptide directed towards the N terminal of human TBC1D16. Synthetic peptide located within the following region: EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: TBC1 domain family member 16
• Database Link:
  NP_061893
  Entrez Gene 125058 Human
  UniProt ID Q8TBP0
• Background: TBC1D16 may act as a GTPase-activating protein for Rab family protein(s).
• Synonyms: FLJ20748; MGC25062
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%