Antibodies

Jump to Filters
View as table Download
KPNA3 Rabbit Polyclonal Antibody
TA319673

USD 570.00

2 Weeks

Rabbit Polyclonal KPNA3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KPNA3 antibody was raised against a 14 amino acid synthetic peptide near the carboxy end of human KPNA3.
KPNA3 Rabbit Polyclonal Antibody
TA335052

USD 539.00

5 Days

Rabbit Polyclonal Anti-KPNA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KPNA3 antibody: synthetic peptide directed towards the N terminal of human KPNA3. Synthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV
KPNA3 Goat Polyclonal Antibody
TA302524

USD 520.00

In Stock

Goat Polyclonal Antibody against KPNA3 / IPOA4

Applications IHC, WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPTANLQTKEFNF, from the C Terminus of the protein sequence according to NP_002258.
KPNA3 Rabbit Polyclonal Antibody
TA377888

USD 365.00

3 Weeks

KPNA3 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human KPNA3 (NP_002258.2).
Modifications Unmodified