Antibodies

View as table Download

Rabbit polyclonal antibody to C1orf165 (chromosome 1 open reading frame 165)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 255 of C1orf165 (Uniprot ID#Q7L4P6)

Rabbit Polyclonal Anti-BEND5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BEND5 antibody is: synthetic peptide directed towards the N-terminal region of Human BEND5. Synthetic peptide located within the following region: EDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIKRPEGR