BEN Domain Containing Protein 5 (BEND5) Rabbit Polyclonal Antibody

CAT#: TA337986

Rabbit Polyclonal Anti-BEND5 Antibody

Product Images

WB Suggested Anti-BEND5 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BEND5 antibody is: synthetic peptide directed towards the N-terminal region of Human BEND5. Synthetic peptide located within the following region: EDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIKRPEGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: BEN domain containing 5
• Database Link:
  NP_078879
  Entrez Gene 79656 Human
  UniProt ID Q7L4P6
• Background: The function of this protein remains unknown.
• Synonyms: C1orf165
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Pig: 86%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%