C15ORF27 (TMEM266) (NM_152335) Human Recombinant Protein

CAT#: TP321441

Recombinant protein of human chromosome 15 open reading frame 27 (C15orf27), 20 µg

Product Images

Coomassie blue staining of purified TMEM266 protein (Cat# TP321441). The protein was produced from HEK293T cells transfected with TMEM266 cDNA clone (Cat# RC221441) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221441 representing NM_152335
  Red=Cloning site Green=Tags(s)
  
  MAVAPSFNMTNPQPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTAGSQLLSNLDE
  DYQREGSNWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDIKLLQFSSAFQFAGVIHW
  ISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMLRIW
  RVKRVIDAYVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAA
  LQAPHVLSQPRSRFKVLEAGTWDEETAAESVVEELQPSQEATMKDDMNSYISQYYNGPSSDSGVPEPAVC
  MVTTAAIDIHQPNISSDLFSLDMPLKLGGNGTSATSESASRSSVTRAQSDSSQTLGSSMDCSTAREEPSS
  EPGPSPPPLPSQQQVEEATVQDLLSSLSEDPCPSQKALDPAPLARPSPAGSAQTSPELEHRVSLFNQKNQ
  EGFTVFQIRPVIHFQPTVPMLEDKFRSLESKEQKLHRVPEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 58.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689548
• Locus ID: 123591
• UniProt ID: Q2M3C6
• Cytogenetics: 15q24.2
• Refseq Size: 2414
• Refseq ORF: 1593
• Synonyms: C15orf27; HsHVRP1; hTMEM266; HVRP1
• Summary: Voltage-sensor protein present on the post-synaptic side of glutamatergic mossy fibers and granule cells in the cerebellum (PubMed:25165868, PubMed:30810529). Despite the presence of a voltage-sensor segment, does not form a functional ion channel and its precise role remains unclear (PubMed:25165868, PubMed:30810529). Undergoes both rapid and slow structural rearrangements in response to changes in voltage (PubMed:30810529). Contains a zinc-binding site that can regulate the slow conformational transition (PubMed:30810529).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane