ZGPAT (NM_181485) Human Recombinant Protein

CAT#: TP321260

Recombinant protein of human zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified ZGPAT protein (Cat# TP321260). The protein was produced from HEK293T cells transfected with ZGPAT cDNA clone (Cat# RC221260) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221260 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKSRLLAALDEER
  PGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEEEEGEDEEELSGTKVSAPYYS
  SWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQVVSLDELRPF
  QDPDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDS
  DGTGDSSYARVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPR
  GKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNEKLQGQAPGALEAGAAPAGRR
  SKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEALARNAGRHSVASAQLQEKLAGAQRQLGQLRA
  QEAGLQQEQRKADTHKKMTEF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 55.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_852150
• Locus ID: 84619
• UniProt ID: Q8N5A5, A0A0S2Z5X3
• Cytogenetics: 20q13.33
• Refseq Size: 1898
• Refseq ORF: 1533
• Synonyms: GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP
• Summary: Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor. Able to suppress breast carcinogenesis.[UniProtKB/Swiss-Prot Function]