CBLN3 (NM_001039771) Human Recombinant Protein
CAT#: TP317397
Recombinant protein of human cerebellin 3 precursor (CBLN3), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217397 representing NM_001039771
Red=Cloning site Green=Tags(s) MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPG RVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQ VSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034860 |
Locus ID | 643866 |
UniProt ID | Q6UW01 |
Cytogenetics | 14q12 |
Refseq Size | 2340 |
Refseq ORF | 615 |
Synonyms | PRO1486 |
Summary | Members of the precerebellin family, such as CBLN3, contain a cerebellin motif (see CBLN1; MIM 600432) and a C-terminal C1q signature domain (see MIM 120550) that mediates trimeric assembly of atypical collagen complexes. However, precerebellins do not contain a collagen motif, suggesting that they are not conventional components of the extracellular matrix (Pang et al., 2000 [PubMed 10964938]).[supplied by OMIM, Aug 2009] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421824 | CBLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421824 | Transient overexpression lysate of cerebellin 3 precursor (CBLN3) |
USD 436.00 |
|
PH317397 | CBLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001034860) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review