XAGE2 (NM_130777) Human Recombinant Protein

CAT#: TP309757

Recombinant protein of human X antigen family, member 2 (XAGE2), 20 µg

Product Images

Coomassie blue staining of purified XAGE2 protein (Cat# TP309757). The protein was produced from HEK293T cells transfected with XAGE2 cDNA clone (Cat# RC209757) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209757 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADL
  QELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_570133
• Locus ID: 9502
• UniProt ID: Q96GT9, A0A024R2A6
• Cytogenetics: Xp11.22
• Refseq Size: 651
• Refseq ORF: 333
• Synonyms: CT12.2; GAGED3; XAGE-2; XAGE2B
• Summary: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq, Jul 2008]