PITPN (PITPNA) (NM_006224) Human Recombinant Protein
CAT#: TP308326
Recombinant protein of human phosphatidylinositol transfer protein, alpha (PITPNA), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208326 protein sequence
Red=Cloning site Green=Tags(s) MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPT FVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVY IDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVE NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006215 |
Locus ID | 5306 |
UniProt ID | Q00169, V9HWC5 |
Cytogenetics | 17p13.3 |
Refseq Size | 3660 |
Refseq ORF | 810 |
Synonyms | HEL-S-36; PI-TPalpha; PITPN; VIB1A |
Summary | This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3) by phosphoinositide-3-kinase.[provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416790 | PITPNA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416790 | Transient overexpression lysate of phosphatidylinositol transfer protein, alpha (PITPNA) |
USD 436.00 |
|
PH308326 | PITPNA MS Standard C13 and N15-labeled recombinant protein (NP_006215) |
USD 3,255.00 |
|
TP720513 | Recombinant protein of human phosphatidylinositol transfer protein, alpha (PITPNA) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review