Triosephosphate isomerase (TPI1) (NM_000365) Human Recombinant Protein

CAT#: TP302652

Recombinant protein of human triosephosphate isomerase 1 (TPI1), 20 µg

Product Images

Coomassie blue staining of purified TPI1 protein (Cat# TP302652). The protein was produced from HEK293T cells transfected with TPI1 cDNA clone (Cat# RC202652) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202652 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKV
  TNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGIT
  EKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYG
  GSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.5 kDa
• Concentration: >0.1 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000356
• Locus ID: 7167
• UniProt ID: P60174, Q53HE2, V9HWK1
• Cytogenetics: 12p13.31
• Refseq Size: 1366
• Refseq ORF: 747
• Synonyms: HEL-S-49; TIM; TPI; TPID
• Summary: This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
• Protein Pathways: Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Inositol phosphate metabolism, Metabolic pathways