Fumarylacetoacetate hydrolase (FAH) (NM_000137) Human Recombinant Protein

CAT#: TP300388

Recombinant protein of human fumarylacetoacetate hydrolase (fumarylacetoacetase) (FAH), 20 µg

Product Images

Coomassie blue staining of purified FAH protein (Cat# TP300388). The protein was produced from HEK293T cells transfected with FAH cDNA clone (Cat# RC200388) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200388 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSF
  MGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPATIGDYTDFYSSRQHATNVGIM
  FRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSKPPVYGACKLLDMELEMAFFVGPGN
  RLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQD
  PRPLPYLCHDEPYTFDINLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGT
  ISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPALLPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000128
• Locus ID: 2184
• UniProt ID: P16930, A0A384P5L6
• Cytogenetics: 15q25.1
• Refseq Size: 1810
• Refseq ORF: 1257
• Summary: This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Tyrosine metabolism