Annexin A10 (ANXA10) (NM_007193) Human Recombinant Protein

CAT#: TP300268

Recombinant protein of human annexin A10 (ANXA10), 20 µg

Product Images

Coomassie blue staining of purified ANXA10 protein (Cat# TP300268). The protein was produced from HEK293T cells transfected with ANXA10 cDNA clone (Cat# RC200268) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200268 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGD
  MREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQ
  EDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLV
  FQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI
  DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGDAEDY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009124
• Locus ID: 11199
• UniProt ID: Q9UJ72
• Cytogenetics: 4q32.3
• Refseq Size: 1447
• Refseq ORF: 972
• Synonyms: ANX14
• Summary: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been determined. [provided by RefSeq, Jul 2008]