Annexin VII (ANXA7) (NM_004034) Human Mass Spec Standard
CAT#: PH321723
ANXA7 MS Standard C13 and N15-labeled recombinant protein (NP_004025)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221723 |
Predicted MW | 52.6 kDa |
Protein Sequence |
>RC221723 representing NM_004034
Red=Cloning site Green=Tags(s) MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGGYPAPG GYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQMPSQYPGGQP TYPSQINTDSFSSYPVFSPVSLDYSSEPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVD VVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVL IEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLY QAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAF FAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004025 |
RefSeq Size | 2176 |
RefSeq ORF | 1464 |
Synonyms | ANX7; SNX; SYNEXIN |
Locus ID | 310 |
UniProt ID | P20073, B2R657 |
Cytogenetics | 10q22.2 |
Summary | Annexin VII is a member of the annexin family of calcium-dependent phospholipid binding proteins.The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle. The transcripts also differ in their 3'-non coding regions by the use of two alternative poly(A) signals. Annexin VII encodes a protein with a molecular weight of approximately 51 kDa with a unique, highly hydrophobic N-terminal domain of 167 amino acids and a conserved C-terminal region of 299 amino acids. The latter domain is composed of alternating hydrophobic and hydrophilic segments. Structural analysis of the protein suggests that Annexin VII is a membrane binding protein with diverse properties, including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400464 | ANXA7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418291 | ANXA7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY400464 | Transient overexpression lysate of annexin A7 (ANXA7), transcript variant 1 |
USD 436.00 |
|
LY418291 | Transient overexpression lysate of annexin A7 (ANXA7), transcript variant 2 |
USD 665.00 |
|
PH301226 | ANXA7 MS Standard C13 and N15-labeled recombinant protein (NP_001147) |
USD 3,255.00 |
|
TP301226 | Recombinant protein of human annexin A7 (ANXA7), transcript variant 1, 20 µg |
USD 867.00 |
|
TP321723 | Recombinant protein of human annexin A7 (ANXA7), transcript variant 2, 20 µg |
USD 867.00 |
|
TP720184 | Recombinant protein of human annexin A7 (ANXA7), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review