CPA5 (NM_080385) Human Mass Spec Standard
CAT#: PH307397
CPA5 MS Standard C13 and N15-labeled recombinant protein (NP_525124)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207397 |
Predicted MW | 49 kDa |
Protein Sequence |
>RC207397 protein sequence
Red=Cloning site Green=Tags(s) MQGTPGGGTRPGPSPVDRRTLLVFSFILAAALGQMNFTGDQVLRVLAKDEKQLSLLGDLEGLKPQKVDFW RGPARPSLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYH TLEEIYSWIDNFVMEHSDIVSKIQIGNSFENQSILVLKFSTGGSRHPAIWIDTGIHSREWITHATGIWTA NKIVSDYGKDRVLTDILNAMDIFIELVTNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGG NGSNSNPCSETYHGPSPQSEPEVAAIVNFITAHGNFKALISIHSYSQMLMYPYGRSLDPVSNQRELYDLA KDAVEALYKVHGIEYIFGSISTTLYVASGITVDWAYDSGIKYAFSFELRDTGQYGFLLPATQIIPTAQET WMALRTIMEHTLNHPY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_525124 |
RefSeq Size | 2078 |
RefSeq ORF | 1308 |
Locus ID | 93979 |
UniProt ID | Q8WXQ8, A4D1M2 |
Cytogenetics | 7q32.2 |
Summary | Carboxypeptidases have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Members of the A/B subfamily of carboxypeptidases, such as CPA5, contain an approximately 90-amino acid pro region that assists in the folding of the active carboxypeptidase domain. Cleavage of the pro region activates the enzyme (Wei et al., 2002 [PubMed 11836249]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409210 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426784 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426785 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409210 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 1 |
USD 436.00 |
|
LY426784 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 2 |
USD 436.00 |
|
LY426785 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 3 |
USD 436.00 |
|
TP307397 | Recombinant protein of human carboxypeptidase A5 (CPA5), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review