MOCS3 (NM_014484) Human Mass Spec Standard

CAT#: PH302099

MOCS3 MS Standard C13 and N15-labeled recombinant protein (NP_055299)

Product Images

Coomassie blue staining of purified MOCS3 protein (Cat# TP302099). The protein was produced from HEK293T cells transfected with MOCS3 cDNA clone (Cat# RC202099) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202099
• Predicted MW: 49.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202099 representing NM_014484
  Red=Cloning site Green=Tags(s)
  
  MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLP
  ELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFS
  AAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEG
  QITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDA
  LRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAF
  HLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQK
  AVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055299
• RefSeq Size: 2458
• RefSeq ORF: 1380
• Synonyms: UBA4
• Locus ID: 27304
• UniProt ID: O95396
• Cytogenetics: 20q13.13
• Summary: Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. [provided by RefSeq, Nov 2012]
• Protein Families: Druggable Genome