ELOVL1 (NM_001256399) Human Tagged ORF Clone

CAT#: RC232364

  • TrueORF®

ELOVL1 (Myc-DDK tagged) - Homo sapiens ELOVL fatty acid elongase 1 (ELOVL1), transcript variant 2

ORF Plasmid: DDK tGFP

AAV Particle: DDK


  "NM_001256399" in other vectors (2)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-ELOVL1 Antibody
    • 100 ul

USD 380.00

Other products for "ELOVL1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ELOVL1
Synonyms CGI-88; IKSHD; Ssc1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC232364 representing NM_001256399
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCTGTTGTGAACTTGTACCAAGAGGTGATGAAGCACGCAGATCCCCGGATCCAGGGCTACCCTC
TGATGGGGTCCCCCTTGCTAATGACCTCCATTCTCCTGACCTACGTGTACTTCGTTCTCTCACTTGGGCC
TCGCATCATGGCTAATCGGAAGCCCTTCCAGCTCCGTGGCTTCATGATTGTCTACAACTTCTCACTGGTG
GCACTCTCCCTCTACATTGTCTATGAGTTCCTGATGTCGGGCTGGCTGAGCACCTATACCTGGCGCTGTG
ACCCTGTGGACTATTCCAACAGCCCTGAGGCACTTAGGATGGTTCGGGTGGCCTGGCTCTTCCTCTTCTC
CAAGTTCATTGAGCTGATGGACACAGTGATCTTTATTCTCCGAAAGAAAGACGGGCAGGTGACCTTCCTA
CATGTCTTCCATCACTCTGTGCTTCCCTGGAGCTGGTGGTGGGGGGTAAAGATTGCCCCGGGAGGAATGG
GCTCTTTCCATGCCATGATAAACTCTTCCGTGCATGTCATAATGTACCTGTACTACGGATTATCTGCCTT
TGGCCCTGTGGCACAACCCTACCTTTGGTGGAAAAAGCACATGACAGCCATTCAGCTGATCCAGTTTGTC
CTGGTCTCACTGCACATCTCCCAGTACTACTTTATGTCCAGCTGTAACTACCAGTACCCAGTCATTATTC
ACCTCATCTGGATGTATGGCACCATCTTCTTCATGCTGTTCTCCAACTTCTGGTATCACTCTTATACCAA
GGGCAAGCGGCTGCCCCGTGCACTTCAGCAAAATGGAGCTCCAGGTATTGCCAAGGTCAAGGCCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC232364 representing NM_001256399
Red=Cloning site Green=Tags(s)

MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLV
ALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFL
HVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFV
LVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001256399
ORF Size 837 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001256399.1, NP_001243328.1
RefSeq Size 1631 bp
RefSeq ORF 840 bp
Locus ID 64834
UniProt ID Q9BW60
Cytogenetics 1p34.2
Protein Families Transmembrane
MW 32.7 kDa
Gene Summary Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that exhibits activity toward saturated and monounsaturated acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. May participate in the production of both saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis. Indirectly inhibits RPE65 via production of VLCFAs.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.