Germany
Japan
United Kingdom
China
SULT6B1 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of sulfotransferase family, cytosolic, 6B, member 1 (SULT6B1)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "SULT6B1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SULT6B1 antibody: synthetic peptide directed towards the C terminal of human SULT6B1. Synthetic peptide located within the following region: FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 30 kDa |
| Gene Name | sulfotransferase family 6B member 1 |
| Database Link | |
| Background | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of thyroxine. Involved in the metabolism of thyroxine. |
| Synonyms | 2410078J06Rik; AV101767; ST6B1 |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Dog: 92%; Rabbit: 92%; Pig: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.