Cfl2 Rabbit Polyclonal Antibody

CAT#: TA346655

Rabbit Polyclonal Anti-Cfl2 Antibody

Product Images

WB Suggested Anti-Cfl2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Cfl2 antibody is: synthetic peptide directed towards the C-terminal region of Cfl2. Synthetic peptide located within the following region: FWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: cofilin 2, muscle
• Database Link:
  NP_031714
  Entrez Gene 12632 Mouse
  UniProt ID P45591
• Background: Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods.
• Synonyms: NEM7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%