SRPR alpha (SRPRA) Rabbit Polyclonal Antibody

CAT#: TA345836

Rabbit Polyclonal Anti-SRPR Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of signal recognition particle receptor (docking protein) (SRPR)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human signal recognition particle receptor (docking protein) (SRPR), transcript variant 2, 20 µg
    • 20 ug

USD 867.00

Other products for "SRPR alpha"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SRPR antibody: synthetic peptide directed towards the middle region of human SRPR. Synthetic peptide located within the following region: EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 70 kDa
Gene Name SRP receptor alpha subunit
Background SRPR belongs to the GTP-binding SRP family. It is in conjunction with SRP, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
Synonyms DP; Sralpha; SRPR
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Protein export

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.