USE1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of unconventional SNARE in the ER 1 homolog (S. cerevisiae) (USE1)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "USE1"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 29 kDa |
Gene Name | unconventional SNARE in the ER 1 |
Database Link | |
Background | MDS032 belongs to the USE1 family and is a component of a SNARE complex which may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. |
Synonyms | D12; MDS032; P31; SLT1 |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 77% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.