USE1 Rabbit Polyclonal Antibody

CAT#: TA345255

Rabbit Polyclonal Anti-MDS032 Antibody

Product Images

WB Suggested Anti-MDS032 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate; USE1 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: unconventional SNARE in the ER 1
• Database Link:
  NP_060937
  Entrez Gene 55850 Human
  UniProt ID Q9NZ43
• Background: MDS032 belongs to the USE1 family and is a component of a SNARE complex which may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
• Synonyms: D12; MDS032; P31; SLT1
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport