IKB zeta (NFKBIZ) Rabbit Polyclonal Antibody

CAT#: TA344659

Rabbit Polyclonal Anti-Nfkbiz Antibody - C-terminal region

Product Images

WB Suggested Anti-Nfkbiz Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Nfkbiz antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: NFKB inhibitor zeta
• Database Link:
  NP_113607
  Entrez Gene 64332 Human
  UniProt ID Q9BYH8
• Background: Nfkbiz is involved in regulation of NF-kappa-B transcription factor complexes. It inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. It inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. It seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50, Nfkbiz has transcriptional activation activity and, together with NFKB1/p50 and RELA, Nfkbiz is recruited to LCN2 promoters.
• Synonyms: IKBZ; INAP; MAIL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%

Reference Data

• Protein Families: Druggable Genome