RG9MTD2 (TRMT10A) Rabbit Polyclonal Antibody

CAT#: TA344004

Rabbit Polyclonal Anti-RG9MTD2 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "RG9MTD2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RG9MTD2 antibody: synthetic peptide directed towards the middle region of human RG9MTD2. Synthetic peptide located within the following region: EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name tRNA methyltransferase 10A
Background The function remains unknown.
Synonyms HEL-S-88; MSSGM; MSSGM1; RG9MTD2; TRM10
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 92%; Mouse: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.