TAF6L Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "TAF6L"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TAF6L antibody is: synthetic peptide directed towards the C-terminal region of Human TAF6L. Synthetic peptide located within the following region: GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 68 kDa |
Gene Name | TATA-box binding protein associated factor 6 like |
Database Link | |
Background | TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF6Lis a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF6. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. |
Synonyms | PAF65A |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.