TCEAL1 Rabbit Polyclonal Antibody

CAT#: TA343484

Rabbit Polyclonal Anti-TCEAL1 Antibody

Product Images

WB Suggested Anti-TCEAL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCEAL1 antibody: synthetic peptide directed towards the middle region of human TCEAL1. Synthetic peptide located within the following region: RPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: transcription elongation factor A like 1
• Database Link:
  NP_004771
  Entrez Gene 9338 Human
  UniProt ID Q15170
• Background: TCEAL1 is a member of the transcription elongation factor A (SII)-like (TCEAL) protein family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. TCEAL1 is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.
• Synonyms: p21; pp21; SIIR; WEX9
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 85%; Horse: 85%; Bovine: 85%

Reference Data

• Protein Families: Transcription Factors