PNRC1 Rabbit Polyclonal Antibody

CAT#: TA340140

Rabbit Polyclonal Anti-PNRC1 Antibody

Product Images

WB Suggested Anti-PNRC1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PNRC1 antibody: synthetic peptide directed towards the middle region of human PNRC1. Synthetic peptide located within the following region: KEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: proline rich nuclear receptor coactivator 1
• Database Link:
  NP_006804
  Entrez Gene 10957 Human
  UniProt ID Q12796
• Background: PNRC1 is a nuclear receptor coactivator. PNRC1 may play a role in signal transduction.
• Synonyms: B4-2; PNAS-145; PROL2; PRR2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors