Germany
Japan
United Kingdom
China
FAM164B (ZC2HC1B) Rabbit Polyclonal Antibody
Product Images
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Recombinant protein of human family with sequence similarity 164, member B (FAM164B), 20 µg
USD 867.00
Other products for "FAM164B"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-C6orf94 antibody: synthetic peptide directed towards the N terminal of human C6orf94. Synthetic peptide located within the following region: PICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHE |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 25 kDa |
| Gene Name | zinc finger C2HC-type containing 1B |
| Database Link | |
| Background | The function of C6orf94 remains unknown. |
| Synonyms | C6orf94; dJ468K18.5; FAM164B |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 79%; Rat: 79%; Bovine: 79%; Guinea pig: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.