SMYD3 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of SET and MYND domain containing 3 (SMYD3), transcript variant 2
USD 436.00
Recombinant protein of human SET and MYND domain containing 3 (SMYD3), 20 µg
USD 867.00
Other products for "SMYD3"
Specifications
Product Data | |
Applications | 10k-ChIP, WB |
Recommended Dilution | WB, CHIP |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the N terminal of human SMYD3. Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 42 kDa |
Gene Name | SET and MYND domain containing 3 |
Database Link | |
Background | SMYD3 is a member of an RNA polymerase complex. Within the RNA polymerase complex, it acts as a histone methyltransferase that plays a role in transcriptional regulation.SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | bA74P14.1; KMT3E; ZMYND1; ZNFN3A1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.