Gpat3 Rabbit Polyclonal Antibody

CAT#: TA339622

Rabbit Polyclonal Anti-Agpat9 Antibody

Product Images

Host: Rabbit; Target Name: Agpat9; Sample Tissue: Rat Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Agpat9 antibody is: synthetic peptide directed towards the middle region of Rat Agpat9. Synthetic peptide located within the following region: HGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: glycerol-3-phosphate acyltransferase 3
• Database Link:
  NP_001020841
  Entrez Gene 305166 Rat
  UniProt ID Q4V8J4
• Background: Agpat9 esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%