SGK196 (POMK) Rabbit Polyclonal Antibody

CAT#: TA339605

Rabbit Polyclonal Anti-SGK196 Antibody

Product Images

Lanes: Lane 1: 30ug mouse renal epithelial lysate; Lane 2: 30ug mouse renal epithelial lysate; Lane 3: 30ug mouse renal epithelial lysate; Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 2500; Gene N

• 

  WB Suggested Anti-SGK196 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLJ23356 antibody: synthetic peptide directed towards the N terminal of human FLJ23356. Synthetic peptide located within the following region: CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: protein-O-mannose kinase
• Database Link:
  NP_115613
  Entrez Gene 74653 MouseEntrez Gene 84197 Human
  UniProt ID Q9H5K3
• Background: The exact function of SGK196 remains unknown.
• Synonyms: MDDGA12; MDDGC12; SGK196
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transmembrane