NOLC1 Rabbit Polyclonal Antibody

CAT#: TA339273

Rabbit Polyclonal Anti-NOLC1 Antibody

Product Images

NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5 ug/ml.NOLC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Human kidney

• 

  Immunohistochemistry with pFa fixed zebrafish kidney tissue at an antibody concentration of 0.004 using anti-NOLC1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Zebrafish
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NOLC1 antibody: synthetic peptide directed towards the C terminal of human NOLC1. Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: nucleolar and coiled-body phosphoprotein 1
• Database Link:
  NP_004732
  Entrez Gene 9221 Human
  UniProt ID Q14978
• Background: Related to nucleologenesis, may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. May play an important role in transcription catalyzed by RNA polymerase I.
• Synonyms: NOPP130; NOPP140; NS5ATP13; P130
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 92%

Reference Data

• Protein Families: Stem cell - Pluripotency