TRPM4 Rabbit Polyclonal Antibody

CAT#: TA338581

Rabbit Polyclonal Anti-TRPM4 Antibody

Product Images

WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate

• 

  Host: Rabbit; Target Name: TRPM4; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: TRPM4; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: TRPM4; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: TRPM4; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: TRPM4; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: TRPM4; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml

Show all 7 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 134 kDa
• Gene Name: transient receptor potential cation channel subfamily M member 4
• Database Link:
  NP_060106
  Entrez Gene 171143 RatEntrez Gene 54795 Human
  UniProt ID Q8TD43
• Background: The protein encoded by this gene is a calcium-activated nonselective ion channel that mediates transport of monovalent cations across membranes, thereby depolarizing the membrane. The activity of the encoded protein increases with increasing intracellular calcium concentration, but this channel does not transport calcium. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2010]
• Synonyms: hTRPM4; LTrpC4; PFHB1B; TRPM4B
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane