Arpc5 Rabbit Polyclonal Antibody

CAT#: TA337971

Rabbit Polyclonal Anti-Arpc5 Antibody

Product Images

Host: Rabbit; Target Name: Arpc5; Sample Tissue: Mouse Small Intestine lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Arpc5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Arpc5. Synthetic peptide located within the following region: VDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: actin related protein 2/3 complex, subunit 5
• Database Link:
  NP_080645
  Entrez Gene 67771 Mouse
  UniProt ID Q9CPW4
• Background: Arpc5 functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
• Synonyms: ARC16; dJ127C7.3; MGC88523; p16-Arc
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%