ATP8B2 Rabbit Polyclonal Antibody

CAT#: TA336163

Rabbit Polyclonal Anti-ATP8B2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of ATPase, class I, type 8B, member 2 (ATP8B2), transcript variant 2
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human ATPase, class I, type 8B, member 2 (ATP8B2), transcript variant 2, 20 µg
    • 20 ug

USD 867.00

Other products for "ATP8B2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ATP8B2 Antibody: synthetic peptide directed towards the N terminal of human ATP8B2. Synthetic peptide located within the following region: MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44
Gene Name ATPase phospholipid transporting 8B2
Background The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms ATPID
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.