Lunatic Fringe (LFNG) Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Transient overexpression lysate of LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (LFNG), transcript variant 1
USD 436.00
Other products for "Lunatic Fringe"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-LFNG Antibody: synthetic peptide directed towards the N terminal of human LFNG. Synthetic peptide located within the following region: LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 39 kDa |
Gene Name | LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase |
Database Link | |
Background | LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3. This gene encodes a member of the glycosyltransferase superfamily. The encoded protein is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Alternatively spliced transcript variants that encode different isoforms have been described, however, not all variants have been fully characterized. |
Synonyms | SCDO3 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Guinea pig: 100%; Bovine: 93% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Notch signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.