FAM130A2 (CSRNP3) Rabbit Polyclonal Antibody

CAT#: TA335455

Rabbit Polyclonal Anti-CSRNP3 Antibody

Product Images

Host: Rabbit; Target Name: CSRNP3; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CSRNP3 Antibody is: synthetic peptide directed towards the N-terminal region of Human CSRNP3. Synthetic peptide located within the following region: KMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: cysteine and serine rich nuclear protein 3
• Database Link:
  NP_079245
  Entrez Gene 80034 Human
  UniProt ID Q8WYN3
• Background: CSRNP3 binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. It plays a role in apoptosis.
• Synonyms: FAM130A2; PPP1R73; TAIP-2; TAIP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 83%