SLC35G4 Rabbit Polyclonal Antibody

CAT#: TA335320

Rabbit Polyclonal Anti-SLC35G4 Antibody

Product Images

Host: Rabbit; Target Name: SLC35G4; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35G4 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC35G4. Synthetic peptide located within the following region: SHPYFNLPDSTHPSPPSTPPSLHWHQRCQPSDATNGLLVALLGGGLPAGF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: solute carrier family 35 member G4
• Database Link:
  NP_001269229
  Entrez Gene 646000 Human
  UniProt ID P0C7Q5
• Background: The function of this protein remains unknown.
• Synonyms: AMAC1L1; SLC35G4P
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 79%; Horse: 77%