SLC26A8 Rabbit Polyclonal Antibody

CAT#: TA334070

Rabbit Polyclonal Anti-SLC26A8 Antibody

Product Images

Host: Rabbit; Target Name: SLC26A8; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC26A8 Antibody is: synthetic peptide directed towards the middle region of Human SLC26A8. Synthetic peptide located within the following region: VPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: solute carrier family 26 member 8
• Database Link:
  NP_001180405
  Entrez Gene 116369 Human
  UniProt ID Q96RN1
• Background: SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.
• Synonyms: SPGF3; TAT1
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane