SLC25A39 Rabbit Polyclonal Antibody

CAT#: TA333786

Rabbit Polyclonal Anti-SLC25A39 Antibody

Product Images

WB Suggested Anti-SLC25A39 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A39 Antibody: synthetic peptide directed towards the C terminal of human SLC25A39. Synthetic peptide located within the following region: RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: solute carrier family 25 member 39
• Database Link:
  NP_057100
  Entrez Gene 51629 Human
  UniProt ID Q9BZJ4
• Background: SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.
• Synonyms: CGI-69; CGI69
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Transmembrane