CCDC172 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of chromosome 10 open reading frame 96 (C10orf96)
USD 436.00
Recombinant protein of human chromosome 10 open reading frame 96 (C10orf96), 20 µg
USD 867.00
Other products for "CCDC172"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-C10orf96 Antibody: synthetic peptide directed towards the middle region of human C10orf96. Synthetic peptide located within the following region: QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 31 kDa |
Gene Name | coiled-coil domain containing 172 |
Database Link | |
Background | The specific function of this protein remains unknown. |
Synonyms | C10orf96 |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.