CCDC172 Rabbit Polyclonal Antibody

CAT#: TA333361

Rabbit Polyclonal Anti-C10orf96 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of chromosome 10 open reading frame 96 (C10orf96)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human chromosome 10 open reading frame 96 (C10orf96), 20 µg
    • 20 ug

USD 867.00

Other products for "CCDC172"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-C10orf96 Antibody: synthetic peptide directed towards the middle region of human C10orf96. Synthetic peptide located within the following region: QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name coiled-coil domain containing 172
Background The specific function of this protein remains unknown.
Synonyms C10orf96
Note Immunogen sequence homology: Human: 100%; Rat: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.