ABHD14A Rabbit Polyclonal Antibody

CAT#: TA331954

Rabbit Polyclonal Anti-ABHD14A Antibody

Product Images

Host: Rabbit; Target Name: ABHD14A; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml

• 

  Rabbit Anti-ABHD14A Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, weak signal, wide tissue distribution; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ABHD14A Antibody is: synthetic peptide directed towards the middle region of Human ABHD14A. Synthetic peptide located within the following region: DLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: abhydrolase domain containing 14A
• Database Link:
  NP_056222
  Entrez Gene 25864 Human
  UniProt ID Q9BUJ0
• Background: ABHD14A play a possible role in granule neuron development.
• Synonyms: DORZ1
• Note: Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%