Germany
Japan
United Kingdom
China
PRAMEF19 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Recombinant protein of human PRAME family member 19 (PRAMEF19), 20 µg
USD 867.00
Other products for "PRAMEF19"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PRAMEF19 antibody is: synthetic peptide directed towards the N-terminal region of Human PRAMEF19. Synthetic peptide located within the following region: EKQPLKVFMDVCLKEKSVDEDLSFFSGWVQHRRRSVHLCCTKVVNYSMNI |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 45 kDa |
| Gene Name | PRAME family member 19 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | PRAMEF18 |
| Note | Human: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.