CREB5 Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "CREB5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CREB5 antibody: synthetic peptide directed towards the N terminal of human CREB5. Synthetic peptide located within the following region: CSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 53 kDa |
Gene Name | cAMP responsive element binding protein 5 |
Database Link | |
Background | CREB5 belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. This protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Synonyms | CRE-BPA; CREB-5 |
Note | Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Mouse: 92%; Chicken: 85%; Guinea pig: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Prostate cancer |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.