XPD (ERCC2) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), transcript variant 1
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "XPD"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 87 kDa |
Gene Name | ERCC excision repair 2, TFIIH core complex helicase subunit |
Database Link | |
Background | The nucleotide excision repair pathway is a mechanism to repair damage to DNA. ERCC2 is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. This protein has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | COFS2; EM9; TFIIH; TTD; TTD1; XPD |
Note | Immunogen sequence homology: Bovine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Nucleotide excision repair |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.