XPD (ERCC2) Rabbit Polyclonal Antibody

CAT#: TA330046

Rabbit Polyclonal Anti-ERCC2 Antibody

Product Images

WB Suggested Anti-ERCC2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: ERCC excision repair 2, TFIIH core complex helicase subunit
• Database Link:
  NP_000391
  Entrez Gene 2068 Human
  UniProt ID P18074
• Background: The nucleotide excision repair pathway is a mechanism to repair damage to DNA. ERCC2 is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. This protein has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: COFS2; EM9; TFIIH; TTD; TTD1; XPD
• Note: Immunogen sequence homology: Bovine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Nucleotide excision repair