TAL2 Rabbit Polyclonal Antibody

CAT#: TA330033

Rabbit Polyclonal Anti-TAL2 Antibody

Product Images

WB Suggested Anti-TAL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAL2 antibody: synthetic peptide directed towards the middle region of human TAL2. Synthetic peptide located within the following region: LGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: T-cell acute lymphocytic leukemia 2
• Database Link:
  NP_005412
  Entrez Gene 6887 Human
  UniProt ID Q16559
• Background: TAL2 is a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia.
• Synonyms: bHLHa19; T-cell acute lymphocytic leukemia 2
• Note: Immunogen sequence homology: Human: 100%; Bovine: 78%

Reference Data

• Protein Families: Druggable Genome