ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody

CAT#: TA329520

Rabbit Polyclonal anti-ACLY antibody

Product Images

WB Suggested Anti-ACLY Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: ACHN cell lysateACLY is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 121 kDa
• Gene Name: ATP citrate lyase
• Database Link:
  NP_001087
  Entrez Gene 47 Human
  UniProt ID P53396
• Background: RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain (Dear et al., 1993 [PubMed 8099440]). [supplied by OMIM, Mar 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC017291.2, BG828093.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025095 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: ACL; ATPCL; CLATP
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Horse: 92%; Sheep: 92%; Bovine: 92%; Guinea pig: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Citrate cycle (TCA cycle), Metabolic pathways