OriGene Technologies, Inc.
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All D17Wsu104e Proteins

D17Wsu104e (NM_080837) Purified Mouse Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP723409 Purified recombinant protein of Mouse DNA segment, Chr 17, Wayne State University 104, expressed (D17Wsu104e)., 10 µg (Larger pack size?) 199
$139
5 Days
Add to Shopping Cart
spacer
Also for D17Wsu104e (NM_080837)
cDNA Clone shRNA/siRNA Primer Pair Protein Antibody Service

OriGene Data
Species:Mouse Expression Host:E. coli
Expression cDNA Clone or AA Sequence
MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
Tag:Tag-free Predicted MW:15.8 kDa
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Resuspend the protein in the desired concentration in proper buffer
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Protein Families:
Protein Pathways:
 

Reference Data
RefSeq: NP_543027 RefSeq Size: 501 RefSeq ORF: 501
LocusID: 28106 Cytogenetic:  
Synonyms : Il25; Ly6elg
Summary:
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company Copyright © 2014 OriGene Technologies, Inc. All Rights Reserved. Legal Notices.
9620 Medical Center Dr., Suite 200, Rockville, MD 20850 • 1.888.267.4436

Reproduction of any materials from this website is strictly forbidden without permission.

All Products by: Title | Price | Category | Popularity | Best Sellers Topselling Products by: Title | Price | Category | Popularity | Favorites
Popular Categories: Popularity | Our Choices | All-Round Favorites | Title Topselling Categories: Popularity | Our Choices | All-Round Favorites | Title